PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010882
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 506aa    MW: 56269.9 Da    PI: 5.6766
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010882genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box201.4e-061351537
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                C+ ++++ ++l+C+ ++  lC  C  + H+       H
  Cla010882 13 PCDFCNDQVAILYCRADSAKLCLFCDKHVHSAnllsrkH 51
               7***************************99545555556 PP

2zf-B_box24.26.8e-085499342
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                ++C+++ ++++++ C +++  lC++C    H +      H+++p+
  Cla010882 54 SQICDNCRSEPVSIRCSTDNLVLCQECDWDAHGScsvsaaHDRTPI 99
               689*************************999954889999988876 PP

3CCT61.72.3e-21458502145
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                R +a++RYkeKrktR+++K irYesRKa+A++R+RvKGrFvk++e
  Cla010882 458 RGNAMQRYKEKRKTRRYDKYIRYESRKARADTRKRVKGRFVKASE 502
                7789**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.4E-13956IPR000315B-box-type zinc finger
PROSITE profilePS501199.399956IPR000315B-box-type zinc finger
CDDcd000211.74E-51256No hitNo description
PROSITE profilePS5011910.6235299IPR000315B-box-type zinc finger
CDDcd000214.17E-75699No hitNo description
SMARTSM003360.755799IPR000315B-box-type zinc finger
PROSITE profilePS5101715.031458500IPR010402CCT domain
PfamPF062038.9E-16458500IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MVCSKSTSGE TVPCDFCNDQ VAILYCRADS AKLCLFCDKH VHSANLLSRK HVRSQICDNC  60
RSEPVSIRCS TDNLVLCQEC DWDAHGSCSV SAAHDRTPIE GFTGCPSALE LVSLWGFDLG  120
DKKLEESEML VQNWVCSQDL VMPIDYWASS RASATAFSDL IVPNDNPFLF ANLNCTDAAS  180
MFKKQSPSCG KHKQVIYKQL VELLKRDFEG GDDDEGDDNR DVGAGGEDVG LQNLVPETTN  240
GDCYWQGDLE ARRIQKEHDG VFVGAAPPQS LLQQQTSFTS LLTMPPHVGF KDSERSVDGT  300
VVWDSNPNRQ SIQFMLNVSG LSFDEVFSNY LLFGRLRGHK DSNSFDDTYG TGNMGFTIKN  360
FGEFLKETSP TSPKLLGETY QINCSSVHDD ISSFNNNVNN TTLNQGAATC ESINVPNNKL  420
NCGSKNMQPN EQPIIVKGDS ILSTSTTKAD LELLAQNRGN AMQRYKEKRK TRRYDKYIRY  480
ESRKARADTR KRVKGRFVKA SEAPVF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818740.0LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004152125.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
TrEMBLA0A0A0KU410.0A0A0A0KU41_CUCSA; Uncharacterized protein
STRINGVIT_01s0146g00360.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47372843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.22e-68B-box type zinc finger protein with CCT domain